DPCstruct | MC15510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1008 |
|---|---|
| Mean domain length (aa) | 204 ± 33 aa |
| Standard deviation of domain lengths | 33.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 10.59 |
| Pfam Score | 38.43 |
| Assigned Pfam label(s) | CL0431- PF06123- CL0126- CL0672- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8I4S8 | 26-232 | TRLPHHPAMLATGRQTAAPVQLHVEAVELDVRLEPTTYTLAAKAMLGLRSRSLKPLPAIRLLLPAPFAARARIYAVWDHSGFLPWYR… |
| A0A671UCF5 | 13-206 | RCVTKHLNLSLHVDFDRHVIRAKVALTVEVLEDRFSALTLDSRDLKILSVSANGQAAQFTMGPKHSFKGTPLEITLPFDLSRGQHVI… |
| A0A2N5YV11 | 2-197 | None |
| A0A2N5YR18 | 2-174 | None |
| A0A1E3BZW6 | 5-231 | None |
| A0A821MUD1 | 2-210 | None |
| A0A168B0M6 | 3-215 | None |
| A0A2T2RP72 | 59-272 | None |
| A0A800MCY4 | 23-260 | None |
| A0A0R2CEK3 | 398-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.