DPCstruct | MC1551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6VZ87 | 1-153 | MPEITFNFYSKTGTPQQAQTVREVWGNRLRPRDVAFALLAEADTAENHYIFSMLNNSDNPNNNCLAPPNGDGSTRAQPTYFTCPMRV… |
| A0A2W5EDY3 | 1-156 | MSYANLQGPAPDTAIYAEIWKDEIDKNNQLYRESGDRRFLGGNAPVTEAHFVIWSRARSVVVSLLNTASGCVMKQENRDAAARVKLC… |
| A0A5N7MNQ3 | 26-180 | None |
| X5P9U6 | 16-172 | None |
| A0A167HSD4 | 112-277 | None |
| A0A4Q1TZV0 | 2-139 | None |
| A0A6N8RVN2 | 73-229 | None |
| A0A3S0MWI3 | 41-201 | None |
| A0A511GUA6 | 50-204 | None |
| B7WTK3 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.