DPCstruct | MC15508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432ZKC4 | 910-1024 | TGHASLYYQPRKWLPNSLVQLHVGQFLAGDRGAQLTFEHKFKSGIIAGAFAAKTNVSAQEFGEGSFNKGFFISIPFDLLQLRHSRGR… |
| A0A1J7C522 | 1-108 | MKGVLVKASVGQYLAKDKGVTFDLSKRFDSGITAGAYATFTNVSKEEYGEGSFTKGFYLSIPLDVLTVTPNRTRAQFNWTPLTRDGG… |
| A0A182TA46 | 211-325 | None |
| A0A3A0EVI0 | 874-986 | None |
| A0A521YZ20 | 556-684 | None |
| A0A5S9BSK1 | 346-468 | None |
| A0A0M4T2A8 | 691-802 | None |
| A0A351T7L0 | 540-648 | None |
| A0A6S5IZI7 | 136-249 | None |
| A0A259N7E0 | 477-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.