DPCstruct | MC15507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 150 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6RVH5 | 4-149 | LKDRLTADMRAALKARDELTTSTLRMALAAVGTAEVSGKAKRELTDDEVLVVLTKEAKKRREAATAFADAGRAEQAAKETAEGEVLE… |
| A0A381T0H4 | 2-132 | KSREKTTVNVLRMILSDLHNRKIAAGEDLDKEQIVAALRTAVKQRREAAEQFSQGGRQDRAEAELGEIEVIKAYLPKLLESDELSAA… |
| A0A421J4Q5 | 3-166 | None |
| A0A4R0RCK7 | 135-293 | None |
| A0A2W4KG60 | 2-119 | None |
| A0A3S0CUF5 | 1-144 | None |
| A0A522U4K1 | 250-418 | None |
| R7QSP8 | 85-242 | None |
| A0A7W2B0U9 | 3-142 | None |
| A0A101MEA0 | 68-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.