DPCstruct | MC15506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518DZG9 | 13-88 | LQPGDRVELKHEVKVGFRNWEKVTVGEVVRTERRRHGLHYGRNFDDKVFSDIIVLRRDDGELTTVTLDEFSELRKV |
| A0A6N2EQF4 | 1-70 | MRVIAHIPKGDTYLKTSYEGKVRRFGQQKTGSWFAHAKDKKLWIDRLELEMDDGEIMVCNLDQLTRVETV |
| A0A2N9LQL8 | 116-193 | None |
| A0A7C4I4E7 | 15-107 | None |
| A0A7V3NAF8 | 15-90 | None |
| A0A517YXE1 | 9-83 | None |
| A0A2D5E8T3 | 1-70 | None |
| A0A7Y3K013 | 20-98 | None |
| A0A2E1KJI9 | 53-127 | None |
| A0A7X0H4J9 | 15-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.