DPCstruct | MC15505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 245 ± 52 aa |
| Standard deviation of domain lengths | 52.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1B0D1 | 31-251 | KAPDPMRVTRDEFRTVADRLTGGDPAAVRWLAALVTDLAADAKGRAALTPYTAPAGQQSLRSFFTKPLEEVRKDQTTLIRQALTGWR… |
| A0A6I7PMK2 | 14-221 | SARIRDAVNASIAANRDEADWIAAIASDVIPPAAINQLQTTRRDYHYGNLTSVIARTDRSHLARTLFIPWDYADALDNQSLHLDPSE… |
| A0A5D0TRY6 | 1-330 | None |
| A0A2Z3GU18 | 105-359 | None |
| A0A5E6MQE9 | 215-350 | None |
| A0A1E4ZTC6 | 27-254 | None |
| A0A1R3US87 | 105-438 | None |
| A0A7I7MQE2 | 4-209 | None |
| A0A1G1CFT2 | 2-333 | None |
| A0A6L7X7Z7 | 3-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.