DPCstruct | MC15503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 24.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I7PL44 | 14-173 | AAVGGLAAFLAISVGCHDSKREDIPAGAQPLPLGSSVREFNHRQAQKARADAFVFYRYEWDRETAELTEWGARHLNRVLSAMHREHH… |
| A0A517Z6K3 | 296-487 | DLVDAVQRSLRRRRTIDLHFESMSERSQFKTQMTALGCGIISLTTFGMILLLIVGAVFDPRGIEQQRAESAGFILSADDFETGTAEL… |
| A0A5K7XF60 | 42-180 | None |
| A0A5Q4GY12 | 91-260 | None |
| A0A5C6B2L6 | 13-227 | None |
| A0A7V3JJX0 | 6-136 | None |
| A0A7C5SJD3 | 14-140 | None |
| A0A7C1PQD4 | 32-197 | None |
| A0A517XM41 | 23-231 | None |
| A0A349UPE1 | 6-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.