DPCstruct | MC1550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7C116 | 1-57 | MFNNFLTIKEVGIILGFKKSASQKVISELNAELRDKGYRTIQGKINKDYFAERYFLN |
| A0A3R6EKA8 | 2-60 | KGVKEAFIDAGEISQMLGIGMTKAYAIIKEYNAELEAKGYFTMRGKCPRKYFEQKIYGY |
| A0A374X4E8 | 2-52 | None |
| A0A0J1FZ07 | 14-72 | None |
| R5TEP3 | 1-66 | None |
| A0A1G5H7J6 | 57-121 | None |
| E6LMA1 | 22-74 | None |
| A0A2V2E7E1 | 1-60 | None |
| A0A380LM58 | 14-68 | None |
| A0A6L5YTK3 | 2-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.