DPCstruct | MC155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 99.02 |
| Assigned Pfam label(s) | PF20160- CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YFY8 | 25-128 | AFAQPAWNHPAGPKTIFFWAPLIKWCLVIAGLADLARPPQKLSASQNAALTATGAVWTRYSFVIIPKNYSLASVNFFVMCCGLTQLG… |
| A0A0V1FXC3 | 5-100 | QSLLHHPAGPKTIFFWAPLFKWGLVFAGLADLQRPAEHLSFSQSSALALSGIIWSRYSMVIKPKNWSLFGVNVLVALFALITISQAL… |
| A0A2W1BUT6 | 6-86 | None |
| A0A1L9VJ39 | 9-119 | None |
| A0A6P4E150 | 3-99 | None |
| A0A4U6UD49 | 83-183 | None |
| A0A2V0PL11 | 7-102 | None |
| D3BNQ8 | 6-96 | None |
| A0A6L5CRY7 | 68-162 | None |
| A0A4Q4YPB9 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.