DPCstruct | MC15496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M4HE32 | 2-70 | VDDTDIFVMTDKGRAELSAEVSKLPAKLRRCLDMVDGARTAGDFAPNFRPGESGAVLEELRAGGYIARK |
| A0A3A0EKW4 | 20-101 | LPEALVFLKTRLGREESRRAEATIPRRLRTVLALVDGRRSVQVLHTLLHSYRGLDDALDMLHKMGLIEPLPERWDLGPTGSD |
| A0A2G8TDG3 | 4-85 | None |
| A0A7Z1YCP1 | 1-89 | None |
| A0A0Q7DXQ9 | 4-99 | None |
| A0A537B2N7 | 6-84 | None |
| A0A068Z1B6 | 2-78 | None |
| A0A2S5TJA5 | 1-92 | None |
| A0A6G0ZX42 | 7-122 | None |
| A0A1M7PVK9 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.