DPCstruct | MC15495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 192 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 92.50 |
| Assigned Pfam label(s) | CL0484- PF06650- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168KAG6 | 2-136 | IFQFEVYENQRWWLGVNWTTNMMPSERGPWTDNQLKAIPPKEEFELPEPTLQTAIISKDGKQVERTTNKVWSWADGDWWVDMTGEIN… |
| A0A397WDD5 | 20-162 | EDTKTSVDLIYRFVICENQRWWLGLDWTTNLFPNERPPWSNEYNELINDKDTFELPQRKVTETKSPENPNILIRKTIEWEWVDTDWW… |
| A0A6G0X9L6 | 20-118 | None |
| A0A7J6KSR3 | 381-523 | None |
| A0A3B5QMX3 | 63-170 | None |
| A0A067BMG5 | 10-125 | None |
| A0A067BUW3 | 472-629 | None |
| A0A183S5S6 | 14-124 | None |
| A0A0S4JGA9 | 244-361 | None |
| A0A0S4JLI1 | 6-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.