DPCstruct | MC15494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397WC39 | 4-152 | SFRIDNNGNIRLPFGRSVEHYFYSLPISQNIRYKVQSRKRVNDTVKQGLITVERVEGSVDYLSWKTNKGHSKSTNRLDNILRLTENE… |
| A0A015J8N1 | 4-180 | SNFENFIEYNTAENSVNVPFGRTAEYYLKNHPLLKNIRLKSQSQKKTPELVKEGIITIERVEGAVDFIEWRTKTGQTKSTNRIDDIV… |
| A0A397SPY3 | 8-188 | None |
| A0A397JM44 | 1-188 | None |
| A0A2I1ETM0 | 2-192 | None |
| A0A397JCM6 | 2-188 | None |
| A0A397IPX8 | 6-189 | None |
| V4AGS7 | 310-502 | None |
| A0A2I1GWF3 | 7-181 | None |
| A0A1S3ILQ0 | 380-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.