DPCstruct | MC15493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 258 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 11.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 94.37 |
| Assigned Pfam label(s) | PF12140- PF16616- CL0003- CL0004- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397WB42 | 1-86 | MSTFNFTTNILTFETIQGWEVETVEAFLKFKQKDFSLSDAEIQKFVDGSVNGPMLLEVNRDDLISLLGLRLGPALNVSAFAENLKN |
| A0A3Q2YTK7 | 2-72 | PFPLEWSVTDVVRFIRTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAQV |
| A0A5J4YY24 | 248-318 | None |
| A0A7N8XPN6 | 430-516 | None |
| A0A397SR88 | 7-94 | None |
| A0A397SPL3 | 1-104 | None |
| A0A397SMQ7 | 6-89 | None |
| A0A397SLQ1 | 2-96 | None |
| A0A397SAU0 | 99-178 | None |
| A0A819X1H6 | 723-826 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.