DPCstruct | MC1549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 8.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20215 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354D3E7 | 13-132 | NIYLEQVLVNYIDIPIFFLCRGKKQYYIALCTDISKLIYIITKLSFSDAYCLLHGKMPMRDAILKQKEYWLVYSENEISSDIVTKHE… |
| A0A3R6AG60 | 8-127 | QHGDLHLDKILFSFENVPMIFVCRNNKNEYFLCQCVDVITGISWMITPVSTKLLIRMIKDEISMLTAFSESGHDIILADFNKKGLVF… |
| A0A6L7LDX7 | 6-133 | None |
| M2ABJ0 | 3-116 | None |
| A0A656GXE8 | 4-110 | None |
| A0A150D4C6 | 12-131 | None |
| A0A7X3P102 | 71-185 | None |
| A7M4J5 | 6-127 | None |
| A0A0Q5TPY2 | 154-271 | None |
| A0A4R7DW40 | 11-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.