DPCstruct | MC15486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8IWW5 | 116-219 | LNDQLQGSQYARFWATLDSDDLYADLTTDIEGFEELVRVRIATLVSHAYREIDLPILEQWLGMDGDAAKKFITETAGWAIEGSLVKI… |
| G7YMD0 | 1-122 | MLIKLRLRENPNITSGVPGFRDAMVKFIVQIVRQTYQRIHKSLLLRLFDMSEAELRQLIKQNGWTECPPSSPGDPNGPLILVNKHEE… |
| A0A1I8IPV6 | 117-216 | None |
| A0A5K3FNN7 | 6-101 | None |
| A0A816IKQ3 | 401-521 | None |
| A0A6A4JMX6 | 121-219 | None |
| A0A3P6HBE5 | 60-174 | None |
| A0A066WGM3 | 192-310 | None |
| A0A7F8RB85 | 117-209 | None |
| A0A553HRM8 | 672-783 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.