DPCstruct | MC15485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 118 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.01 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | CL0416- PF16178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GN27 | 3-79 | LTFKDGEKSVDYILAYDTFKEDTNHIRKAFEENLIKEGLEIEMENSQQQINFVKIHAPMEVLARYCQLLKLKLPLKV |
| G7YLY0 | 3-126 | LKPESAAKSISPKDQHDAQGPFMHNNEPTRKIQGYYFADGKRKIDYVLVWEDNPDEKHPSKVVRTNRRLRNEYLANLHKIGVETELE… |
| A0A2W1C0R0 | 116-236 | None |
| A0A2W1BRC5 | 2-102 | None |
| A0A1A7XS53 | 2-142 | None |
| A0A3M7P0P4 | 1-94 | None |
| A0A7J8FV62 | 29-155 | None |
| A0A1J1IK63 | 47-143 | None |
| A0A060ZAS9 | 8-121 | None |
| A0A2A2K345 | 17-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.