DPCstruct | MC15483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9JEQ1 | 2-94 | LNGNVLSLPVVSIGSDAYQVELTLVDGSSPIELLVTSGVLLSDANTAGASTFDGVTLAVPSMDVDGMSYWANFDLLTADPPTFVFVD… |
| A0A0R2T2A4 | 21-129 | FVNVSMSALSTSAKFGSGKLSVALNAGAIGQAWVDFAITQSSPDTVITLVPSSTLFIDRTLEDMATFDAFSGTLLIPALEINGAVAY… |
| A0A2D7C0G5 | 183-286 | None |
| A0A522UMA3 | 22-133 | None |
| A0A7C7XP22 | 9-124 | None |
| A0A836WIJ5 | 449-531 | None |
| A0A2E8XKL9 | 17-132 | None |
| A0A2T5I1W9 | 16-126 | None |
| A0A2A5WFQ8 | 225-350 | None |
| A0A1F4D6D0 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.