DPCstruct | MC15480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 184 ± 21 aa |
| Standard deviation of domain lengths | 21.14 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 86.36 |
| Assigned Pfam label(s) | PF03873- CL0645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432XQQ3 | 4-190 | RSYEQLSALLDDAVLDAREREQHLDSLLSDTEAQQAWGRYALMGRIMKNDATTSTPIDISASVAAQIAQEPQPSNVVQGRFGKGREM… |
| A0A2N1DJN3 | 1-178 | MKDVNEQLSAIVDNEFIDEKLIDELLINKDKQDQFCRYHLIGDVMRGDVTDQFINFDISQQVMAEIEKPAKTAPVAEFDSSTATALQ… |
| A0A521ZG95 | 16-165 | None |
| A0A3B1B429 | 1-146 | None |
| A0A3B1BD60 | 1-197 | None |
| A0A1H4E5L3 | 26-213 | None |
| A0A1T2KWY0 | 6-172 | None |
| A0A2T3L1C5 | 1-215 | None |
| A0A2N2RNI1 | 2-167 | None |
| A0A3A4W2G9 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.