DPCstruct | MC1548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 3.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832BL36 | 39-102 | VEMLARAWRYGIDASFVLFDSWFAHDVVIANILTIGYGVICRLKPTRAKYTYQGQSYTLKQLWQ |
| A0A173S8Z1 | 3-77 | LLNTALSAGLKADYVLFDSWFSNPAQVTAIHAKGMDVIAMIKKSSRIKYSYGGEQLNIKEIYSRNKKRRGRSRSF |
| A0A174E3Q4 | 211-284 | None |
| A0A843K5C1 | 207-273 | None |
| F0K2Z9 | 60-128 | None |
| A0A1I6D457 | 26-89 | None |
| W4BQD9 | 2-70 | None |
| E8LFH0 | 70-140 | None |
| A0A4Z0QNE2 | 2-75 | None |
| A0A1M6MSE7 | 206-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.