DPCstruct | MC15479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 234 ± 69 aa |
| Standard deviation of domain lengths | 69.15 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2LPV1 | 52-268 | WRGDYQGLAAFRYDSAVSEFLWSYDIRSDIEIPITGTINAITQDAFTIAEFQIPISLQVTVCLTYIPIIGCVLHVSITVPITTEHLG… |
| A0A2Z5YAR0 | 1-154 | MAGFTLPQISTPQFTTAPITIPPIGLGSFTTPPLTIPSIHLPGTTIGEFAFPAGPGYLNSSATPSSGFFNSGAGGNSGLGNNGSGLS… |
| A0A100ICL7 | 374-524 | None |
| A0A100IET1 | 3-213 | None |
| A0A1X2CJU6 | 2-296 | None |
| A0A109S7X9 | 2-154 | None |
| A0A655JAV5 | 205-399 | None |
| A0A653EUH2 | 406-687 | None |
| A0A1V3W8L7 | 121-426 | None |
| A0A1V3WY08 | 396-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.