DPCstruct | MC15473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5Y1M4 | 15-113 | NPPTTIKIIISKEIEPRHGRFGASLPDGTVLVGSSRQPFLDAARVLIASDYDPDSWLEGWRPGATAFALRGKLGIATGLTVDETRTV… |
| A0A177PL32 | 21-128 | QTTSHRIDLEPAYRVDANGRSAGHGKAFMFFEGECIGESHQPAFDAARYLLAKGLALPSDRLTTYRNGKPCLFTVVGRAAKLTVRED… |
| A0A2U1YTH0 | 1-83 | None |
| A0A0R3MU59 | 2-99 | None |
| A0A1M3KMU3 | 37-137 | None |
| A0A0Q5XER6 | 3-100 | None |
| A0A4S5J6Y6 | 5-111 | None |
| A0A6G6WPE5 | 40-144 | None |
| A0A353YBE3 | 79-180 | None |
| A0A0D6PI70 | 23-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.