DPCstruct | MC15472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 15.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5N369 | 21-132 | SSADDTISEDYRYLARINVRPVVINCVAEIDRWIRTSAKFDMFLAPDVRLLRAKVRAFRAIDGSADNGPSVDSTVTIRASARLRPRA… |
| A0A226X6J2 | 3-98 | VPEPVIRCVAAFDRWVALTPKYDTFIVPDRRVLRAKIDSDTTIFSAGNPIPVDEVIAMRAFAKVRGKPHWTRVDSRCGVRDGHVVGV… |
| A0A855QWY5 | 42-169 | None |
| A0A1W7QNE9 | 2-121 | None |
| A0A0F5K3B0 | 103-234 | None |
| A0A6S6LX72 | 208-333 | None |
| A0A1W1XD65 | 19-120 | None |
| A0A1A5XG34 | 12-140 | None |
| A0A849BEG9 | 74-196 | None |
| A0A0P0RR39 | 16-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.