DPCstruct | MC1547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379W4H8 | 1-68 | MPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCVGSRVLESSPAQMTRLVDVSKAGISKNVYGRVIS |
| A0A6J1UAX7 | 85-151 | MEYTEIRQLPYSVDQMYDIVADVGSYQLFVPWCNCSRIISHHKEVSQAELEVGFPPVVERYVSEISS |
| A0A368GIG7 | 379-447 | None |
| A0A672UTR1 | 14-86 | None |
| A0A6J0IZG6 | 1-76 | None |
| A0A4S4LXP4 | 75-155 | None |
| M7C7I8 | 573-640 | None |
| A0A426ZBZ6 | 129-192 | None |
| A0A4Z2CQX2 | 41-106 | None |
| A0A438DYJ7 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.