DPCstruct | MC15469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534SR63 | 4-81 | EKYLRGVELRRGTYRRYPKNPNWDHDHCAFCGAKFMVEERPNVLHEGYCTLDEYRWICTGCFDDFKEMFGWRVVPTPE |
| A0A0U1NYR9 | 3-79 | KNDWRLTNQEKYLFGKTLTLKKFIPTKTDHEHCEFCWQKIVDENHPDIIREAYTTNDEYYWVCPDCYNDFKEMFKWK |
| A0A2G6H788 | 44-120 | None |
| U5FAC5 | 15-94 | None |
| A0A1C6JVM2 | 1-79 | None |
| A0A1C5Y5V6 | 15-95 | None |
| A0A2E6H0F5 | 92-173 | None |
| A0A6C2TYR5 | 40-125 | None |
| D2MMS7 | 7-94 | None |
| M2BQE5 | 158-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.