DPCstruct | MC15465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819D350 | 164-306 | PEIKIDENGTTLNVVGRTIFLSSIKKKIESMMQGTTILQVDIVARDVFHIDTDLEGKDWQGKNLCVVTEKVNVWGDRIIDVSGSGYA… |
| A0A084VIP2 | 2-167 | ASANQFQIQEKQIDGRTVIEITGVQIVISDLFIHEVESKLKQSSAEEIRIIATECITIGADLKQTIWHGKNIVVLADWVTVSKSVTW… |
| A0A817Q605 | 222-376 | None |
| A0A0C9M2M4 | 17-177 | None |
| E9G5Q8 | 334-503 | None |
| A0A226ESF3 | 589-718 | None |
| A0A813WLT1 | 696-894 | None |
| A0A489F452 | 229-366 | None |
| A0A821SBY5 | 260-414 | None |
| A0A182YBP0 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.