DPCstruct | MC15462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 463 ± 47 aa |
| Standard deviation of domain lengths | 46.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1Q313 | 1-450 | MSNGIQVQRSRTIIKNQWVGVEPGNKDIAMLSRSGFYSFSRAYDLQLKNVRLIPWEKTRGTKETNVPQGTYGISGNVIMNVLFSNIT… |
| A0A359IK49 | 12-502 | MGKNIHITRSNVLIRDLTHTVADNNTGRPYNGFITTQGVCLIHLKDCNLDPRPFTQNVDGVSMGTYDMVFNETVDITLENVNALSKN… |
| A0A347WIJ2 | 367-792 | None |
| A0A556AC45 | 306-713 | None |
| A0A267S0X3 | 496-943 | None |
| A0A447L715 | 72-538 | None |
| A0A443WQF4 | 442-988 | None |
| A0A242D6S2 | 411-945 | None |
| A0A4Y8TR61 | 390-788 | None |
| A0A2B2LJY4 | 435-895 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.