DPCstruct | MC1546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 583 ± 121 aa |
| Standard deviation of domain lengths | 121.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.34 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF04112- CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1U964 | 25-594 | GNTSWIDITQDFEDCCKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKVKDLSLPELIGIMDT… |
| A0A2P7YTQ4 | 226-887 | YVDVTDRFFRSVEGMKPGNVVASQYFDMLEGSRAIEIGNLRLDTGLIKLKQEEIMFDAAAPQDVDNVLGSMNHITMLLMLWFLGLSL… |
| A0A0F7SL68 | 5-623 | None |
| A0A364MVI1 | 336-1033 | None |
| A0A1B7P584 | 62-457 | None |
| A0A194Q2B3 | 268-938 | None |
| A0A5K4EFD3 | 1-642 | None |
| A0A453PYE7 | 5-340 | None |
| A0A6V7U7M1 | 12-451 | None |
| A0A1R0H185 | 1-692 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.