DPCstruct | MC15458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 123 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6M0Q2 | 380-451 | RTADNAQVGSCLKRAGGNDVQVVDCGAPDAAYKVLRTGPTSAFCTSLSGVIATYSYKRSGDIFTTYLCLGSA |
| A0A5C5RXM8 | 48-156 | MDEGRPLYRRLGMLGLLIPLAVLGWLLYNKFIVHEYDATGASAGECVATSGDRLTVVVGCNEPRADYRVAGRLPGTVDPAGCEAYPS… |
| A0A543IU44 | 6-108 | None |
| A0A386ZCA0 | 27-154 | None |
| A0A1S1RAL8 | 60-173 | None |
| A0A7I7XYK8 | 4-77 | None |
| D3PYN2 | 23-147 | None |
| A0A846W5Y2 | 1-197 | None |
| A0A1T3NZ68 | 55-180 | None |
| A0A7Y0JQU9 | 5-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.