DPCstruct | MC15457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 665 ± 59 aa |
| Standard deviation of domain lengths | 59.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 61.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.16 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 80.36 |
| Assigned Pfam label(s) | PF01805- CL0449- PF07713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8NJN9 | 1-609 | MDEEDIREAEESRNLHITDEFSGFGSTDVDANRRGGLMDLFRSGGETMGVKLLKRMGWKEGQGVGPKVRRRAHLGDDAAYSSGSTDK… |
| W7HTR0 | 1-715 | MSRNHASKRSRTAFEKEDTSPYLIYGTPIESDAKSRDKDAFLPVWKQEVVDERGRKRLHGAFTGGFSAGYFNTVGSKEGWTPSTFVS… |
| A0A0D0YB03 | 10-720 | None |
| A0A485NKF0 | 1-628 | None |
| A0A1X2GBA7 | 38-591 | None |
| B8B2G4 | 5-738 | None |
| A0A1Q3EL54 | 28-730 | None |
| A8Q3D7 | 2-609 | None |
| A0A673MJF0 | 1-656 | None |
| A0A067Q4Q4 | 19-748 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.