DPCstruct | MC15453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 75.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4CL25 | 1-54 | MVLGMPWLARHDPVIDWTKRTIVHFGSSSATVSDGPVGAAHAPRGACDPPAEAA |
| A0A6A4B7M9 | 1-46 | MVLGMTWLARHDPVIDWTKRTIVHFGSSSVTVSDDPVGAAHSPRGA |
| A0A6G0JQM8 | 1-54 | None |
| A0A6A3H1I8 | 30-83 | None |
| A0A6A3HLZ0 | 1-40 | None |
| A0A225UBD4 | 1-54 | None |
| A0A225UMA2 | 1-54 | None |
| A0A225VIT2 | 1-54 | None |
| A0A6A3N5D3 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.