DPCstruct | MC15452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 354 ± 50 aa |
| Standard deviation of domain lengths | 49.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4CAW1 | 282-646 | LTQYASLHVMPVFMVLKKHEGHFYGVRHGDVSTKWHAEGDASFTRNHCEGHDWYEEVLTHIKYGQRNAASVDPLQSDDATNMVIIGA… |
| A0A6A4C0V0 | 2-365 | LANYARLHVMPVFLVLKRHEGHFYGVHHGDVSTKWQAEGDEVFTKEHCTSHSWYAEVLAHHEYSRGKLGQTDAISDTAETNEVLIGA… |
| A0A6A3LH53 | 32-389 | None |
| A0A6G0QKP0 | 809-1098 | None |
| A0A6G0SM94 | 328-694 | None |
| A0A6G0QLB9 | 411-806 | None |
| A0A6A3H5H6 | 253-587 | None |
| A0A6A3HS17 | 117-489 | None |
| A0A6A4BG63 | 1-405 | None |
| A0A6G0KQU6 | 246-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.