DPCstruct | MC15451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4YS88 | 195-260 | TSDDLCGSVLYKECHLNGIQGICYNTRMMVISCVTQSAYIEMRQLQIERRVGDPCNVTVEAWLGCK |
| A0A6A4BLZ5 | 1-65 | MDPCKGTLYRQCVDPSGVESMCYNARFMGIACDTNPFPIRMRRLQIARGVGDPCDPEYEAWLGCR |
| A0A833W9H6 | 286-354 | None |
| A0A6A3QTJ4 | 68-133 | None |
| A0A662Y370 | 336-399 | None |
| K3XAC1 | 388-462 | None |
| K3WG74 | 158-216 | None |
| G5A3X2 | 527-594 | None |
| G4ZMT1 | 1113-1177 | None |
| G4ZEG2 | 483-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.