DPCstruct | MC15450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 227 ± 61 aa |
| Standard deviation of domain lengths | 60.66 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 72.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2PRM2 | 1-182 | MQCSRPAPKRYFRFDLTVGTPQDVADDLEALFKVAALKDVSVHELSYPWTDSEVWYDQDAFFHIHVEHWRWWMKFRPAFFDWQLNIP… |
| A0A6A4BBS3 | 28-215 | MGLAAQALSGPRRRGPYPPSRPRGSASKKQKVSASTKSNPVALGTPHITFPLATGLPKKFVRDLEGIFRHVAVINLKAWQRAYPWVN… |
| A0A329RF49 | 1-168 | None |
| A0A6A3ZEU6 | 86-269 | None |
| A0A6A3MWV6 | 35-228 | None |
| W2PPX9 | 119-331 | None |
| A0A081AU14 | 7-186 | None |
| A0A080Z2B1 | 13-331 | None |
| A0A6A4EV15 | 3-193 | None |
| A0A6A3ZHL6 | 39-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.