DPCstruct | MC1545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 567 ± 33 aa |
| Standard deviation of domain lengths | 32.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17392- CL0063- PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5RPN5 | 2-549 | RTIRAPRGTQLSCKGWQQEAAMRMIMNNLDPEVAEKPQDLVVYGGIGKAARNWQAFDAIIDSLKTLENDETLLVQSGKPVGIIKTHS… |
| A0A840XH15 | 18-569 | RPASGPRPVRAHRGTQLHTLGWQQEGALRMLQNNLDPEVAEHPDELVVYGGTGKAARDWASFDALTRTLATLKGDETMLVQSGRPVG… |
| A0A6J0WH13 | 8-646 | None |
| A0A521WL82 | 84-690 | None |
| A0A3F2RPA1 | 434-1030 | None |
| A9WN96 | 232-794 | None |
| A0A3P9KAA8 | 76-666 | None |
| A0A535YS62 | 472-1022 | None |
| W4SL99 | 3-575 | None |
| A0A1Y5RE61 | 297-850 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.