DPCstruct | MC15448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4317 |
|---|---|
| Mean domain length (aa) | 133 ± 26 aa |
| Standard deviation of domain lengths | 26.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.64 |
| Pfam Score | 91.17 |
| Assigned Pfam label(s) | CL0020- PF18701- CL0177- CL0153- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TCF6 | 1-124 | MKSVAGTKWVNQHIQRLKSLGRWMKAVPERESFRFGDGHEVWSEFSFIFEATLLGVRVVLRLSVVPGDCPPLLSKPACTQLGIVIDT… |
| A0A6A4AUT0 | 14-133 | DHEQEGSREVTLVHGAVNDLRVQILLDTGTSGSMASLNLARRLKLKLQVLPEPIKVSGLGGVPSYITASAKVKITLEVRVVYITNVW… |
| A0A1J9RH95 | 62-217 | None |
| A0A3S0ZLF6 | 83-237 | None |
| A0A2D0QJ66 | 238-378 | None |
| A0A803J5T0 | 91-205 | None |
| A0A6D2I6C7 | 63-200 | None |
| A0A6D2I4J7 | 157-252 | None |
| A0A6D2HVU5 | 184-287 | None |
| A0A6D2HZP3 | 37-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.