DPCstruct | MC15447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 181 ± 23 aa |
| Standard deviation of domain lengths | 22.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8CT95 | 179-336 | CPLGVEPDGETCTFSYEVLGYIALDDVVGITSMVNPQTSNYYANYAEFCEAGGVEFSVTVSSYGVTWNEGLDFWANPGDSTANAERA… |
| A0A6A3PJ12 | 1-207 | MDTLPDGVTCTFNYRVLGYVPIDDVVGITAMTNKATDNKLANFTEFCEAGGIEFQASETGVWNASIPFWKNPQNASANAARTEKLLS… |
| M4C0E3 | 314-479 | None |
| A0A024GMG7 | 158-362 | None |
| A0A2P4X2J2 | 1-169 | None |
| A0A6A3MFJ6 | 806-973 | None |
| A0A3L6VJQ7 | 145-301 | None |
| A0A6A3FUA5 | 226-382 | None |
| A0A329SY53 | 226-433 | None |
| A0A1V9YPZ5 | 1045-1256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.