DPCstruct | MC15446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 399 ± 76 aa |
| Standard deviation of domain lengths | 75.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3P7V9 | 256-699 | SVNRMRNFDEYRRNTSAFRALFFCFILPFPCLIVLSMVDAAPLAPPSSSPNANYMFWIRDSILIMLLTRAMIEQISINVPGLHMTDM… |
| A0A813I3Q3 | 183-584 | RRAAKVARALGALTINEARDYLFTWDAFSPPYQERLAAAESAAPWPAVLLATLPLLPALAFMAFPYAPASDSWEKQGAFFSAVIAFG… |
| W2PZF1 | 34-490 | None |
| A0A6A3SS93 | 27-479 | None |
| G5A365 | 21-432 | None |
| G4ZI50 | 30-296 | None |
| A0A662XN63 | 2-487 | None |
| A0A662XWV2 | 32-483 | None |
| A0A833SN08 | 30-379 | None |
| A0A5D6XNF8 | 4-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.