DPCstruct | MC15445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 151 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3P380 | 19-168 | TEAAGAAVVSAGRSSRVRPLARNLVDELDDVAKPELAFGDDDDDESDVKGPKHRPPLNGDTSAANKVLGRYLELTKTKSNWMRQFSP… |
| A0A6A3H811 | 26-176 | EEDAEEMSLHVTKMGTPRPVERSLVAEFGEDADDDEQDVVPSQRPPRILRATRNADTPSANKVLAKLGEDMRSTGGWLSKFEPKPMA… |
| A0A6A3Q9F5 | 1-136 | None |
| A0A6G0R582 | 18-178 | None |
| A0A6A4E0Q6 | 1-119 | None |
| A0A6A4CM63 | 12-162 | None |
| A0A225V8V2 | 68-199 | None |
| A0A225V4A6 | 1-147 | None |
| A0A225UQ74 | 1-112 | None |
| A0A225VKM3 | 58-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.