DPCstruct | MC15444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3P090 | 14-89 | PTLLAPNTPYCTDLERIYGGEQTSFSAPQHEGQSLLLSDASVENWPTLERTVSCEQWPATYFPIESENEHSRIKSD |
| W2VYH0 | 118-214 | DTDIAFFWSWMEPLVEDMLGVTPLLAAGGTPYCSDLDAIMSGSSSKFTTPFETGQSTLLMNASVENWEYLLQAVDCSPSYGLTLFPL… |
| A0A662X9N2 | 47-123 | None |
| W2FTN7 | 3-76 | None |
| A0A6A3QQD0 | 13-92 | None |
| A0A662WRN0 | 929-1024 | None |
| W2M152 | 3-80 | None |
| A0A6A4BVJ8 | 95-176 | None |
| A0A329SP08 | 4-85 | None |
| A0A6A3XNZ9 | 266-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.