DPCstruct | MC15443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 16.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1BUJ6 | 1-169 | MVSTKLADPGAFDSTEIDEVAHLTDLDDYLELLYEDTGDKLRASALVLQLARNPDNLEELFQNETLVGALARVLREDWRKSTDLATN… |
| A0A7J7SRH9 | 1-144 | MEIDEVANINDMDEYIELLYEDIPDKVRGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSQF… |
| A0A0D8Y8J0 | 118-251 | None |
| A0A662WW95 | 7-173 | None |
| A0A1Y1NJ08 | 148-280 | None |
| A0A654H2F7 | 884-1051 | None |
| A0A2K6CCS2 | 103-263 | None |
| A0A812SET9 | 465-645 | None |
| A0A0P7V0L4 | 111-250 | None |
| A0A6J1LTP6 | 158-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.