DPCstruct | MC15442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 296 ± 43 aa |
| Standard deviation of domain lengths | 42.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7SDJ8 | 49-311 | QQRFDELCCRLNMDEAARTEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRLLRCSEQSLIEFFNKM… |
| A0A5E4BIW0 | 8-334 | ADGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVMHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSA… |
| B4DT45 | 10-303 | None |
| A0A0C2JEK9 | 21-364 | None |
| H3A6T9 | 2-280 | None |
| A0A0R3TCL5 | 10-343 | None |
| A0A6A4WHR6 | 13-308 | None |
| A0A8B6CB80 | 17-259 | None |
| A0A6J2JX45 | 44-329 | None |
| A0A183F485 | 50-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.