DPCstruct | MC15441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 86.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5C7Y1 | 6-69 | LMRRELACEGYPIELRCPGSDVIMIETANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCN |
| A0A7J7R9L0 | 24-95 | GLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQR |
| A0A553MYT4 | 80-140 | None |
| A0A673YK51 | 10-73 | None |
| A0A2I0U6L3 | 1-64 | None |
| A0A672KFY6 | 16-81 | None |
| A0A498P146 | 7-77 | None |
| A0A5A9NHQ3 | 39-104 | None |
| H3AXC3 | 25-96 | None |
| H3AXC4 | 6-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.