DPCstruct | MC15440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8W3D2 | 163-293 | LNIIRLLDIKIYENNLFTRCLHCNSNEFILALRHELQVMCYGQALDDVKELSAGNVSPYERTFNLLNVNQDVLKSKTTYRGKPIKLN… |
| A0A7J7QYY4 | 5-141 | ACNCDQYLKVSRDLMTQLVGLSGQGDPSSAGDKAQSEDTQEPGSAPGETPGLTYDPPCRWLEAAELRARDPATLGNGTRLQLAGVPA… |
| A0A146W722 | 512-655 | None |
| A0A6I9NDQ4 | 1-134 | None |
| A0A7E6ENP0 | 478-632 | None |
| H3C4I5 | 4-123 | None |
| V4ALW2 | 613-735 | None |
| A0A5A9N168 | 83-209 | None |
| T1HKD7 | 22-141 | None |
| A0A1S3J517 | 274-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.