DPCstruct | MC1544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855K7M0 | 6-69 | LTVEPLTVELSYTAVRAYLRWGKRHHPAALNICDVFAYALATAHNCPMLFVGDDFARTDVAAAL |
| A0A840X456 | 6-73 | DRFRVTTTDFTAAHAHAAVAAWARYGRGRHAAKLNYGDCMAYATAKLAGEPLLYVGDNFALTDVESVL |
| W0DP01 | 1-62 | None |
| R4V7R3 | 25-84 | None |
| A0A6L7YKW1 | 1-60 | None |
| A0A7I0J6L0 | 2-52 | None |
| A0A429Z1Y4 | 13-79 | None |
| A0A7W5KX31 | 39-106 | None |
| A0A5J5IYL4 | 13-70 | None |
| A0A655J013 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.