DPCstruct | MC15438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 45.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D7Q1Q0 | 13-83 | PEPYGILLRKDDTAFKAIADAATASLYQSPELAALYDKWFTQPIPPKGVNLDIPMSPAMKRAFAKPTDSPD |
| A0A1B3E8N9 | 16-72 | EAFKKVVDKAIADTFASGEINGIYDKWFIQPIPPKGLNLNFPMSNELKQLVAQPTDK |
| A0A6J5F1Z6 | 43-112 | None |
| A0A6P2PL22 | 79-148 | None |
| A0A6J5JBQ1 | 28-97 | None |
| A0A6N6XJS6 | 24-94 | None |
| F1W591 | 61-133 | None |
| A0A534XY24 | 156-226 | None |
| X1FNM3 | 2-73 | None |
| A0A1V5XQD5 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.