DPCstruct | MC15436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 238 ± 22 aa |
| Standard deviation of domain lengths | 22.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8SXF2 | 278-493 | IYRDRTHWQPPVRQSDRGTAMFLSSLRVTASLVKEMSKIEADTDAVLHVFDVLIGFSPALRTFYLLTQGRTPTAQECAALSHAVFYA… |
| A0A087XND6 | 2-239 | FYFNNVVPSVSQTLKGISVFFSSLYAIAEHTDVPRKMLLAYVRKLTGCNALVQSLHQLCRNERVTRNQKIAVVEGLYMLFRELLPKQ… |
| A0A177DPL0 | 333-628 | None |
| A0A1S3PVJ4 | 1-219 | None |
| A0A1X7US04 | 323-536 | None |
| A0A060XYP6 | 80-321 | None |
| A0A060XLK0 | 3-248 | None |
| A0A7C8I460 | 23-262 | None |
| A0A1V8TP23 | 12-252 | None |
| A0A0G4EQX7 | 763-1004 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.