DPCstruct | MC15433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6120 |
|---|---|
| Mean domain length (aa) | 193 ± 43 aa |
| Standard deviation of domain lengths | 42.94 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.70 |
| Pfam Score | 91.31 |
| Assigned Pfam label(s) | PF12631- CL0669- PF05478- CL0219- PF16897 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A087X686 | 7-205 | IPNDFTRRIVVLGKTGAGKSSLANTLLGENVCKPDDSAVSGTSRCQAESRTVNGRSIKLIDTPGFFDTMRSEEVMKVEIMKCIIESA… |
| A0A4R1BIS8 | 248-448 | AAQNRRWLAEQGVFAVNLVSSPGSGKTTLLVKTIEALAGEPPVSVVEGDQQTSNDADRIRATGAAAVQVNTGKGCHLDALMVGQALT… |
| A0A397EKC9 | 143-336 | None |
| A0A7S2N281 | 183-376 | None |
| A0A7S2JAH7 | 2-162 | None |
| A0A4V5NJ14 | 1-149 | None |
| A0A4U0XWQ0 | 15-253 | None |
| A0A2G8L030 | 124-334 | None |
| A0A4U0XSE0 | 22-277 | None |
| A0A061R0R1 | 3-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.