DPCstruct | MC15432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143ZEA4 | 18-137 | IGGEKRKFVISKIIDILDDFRLSRFENEGAIRAGVRSALCLAGNGWHPSDSEAAALLATAFTKMGAHRPSWLEGQKEYVLAQEECFQ… |
| A0A3D9BJN0 | 11-143 | RRERDAARERLAKDRAEKIVGNLCAVTRLALEEGRILTTLAYEGTFRATIRSELCLQGWSWQAADDTAQDVVAVVFSILQVKRPDWY… |
| A0A212KXL4 | 58-192 | None |
| A0A7H9BUW3 | 45-168 | None |
| A0A0P0Z456 | 25-164 | None |
| A0A7W5QY67 | 26-148 | None |
| A0A8B2NRW1 | 2-123 | None |
| A0A4Q0MJM0 | 25-146 | None |
| A0A2E8PD60 | 10-127 | None |
| A0A098S0V7 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.