DPCstruct | MC15430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 159 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813QJI1 | 255-426 | KTFNRNRFKITCQEYFETGQVFSPVISNKRESVLMVKKGFFKIDLGACFSKRNFVDEYFINRFKNSNYFVDFKLRDRNVYVYLNETF… |
| M5XVR0 | 4-148 | TVLSSEAKDAAVEIEHRLQLGSKLSDLVNSKEDVLALLSLYKDEGYIFTEHKGRFCVVLKETSSLQDMLRALFHVNYLYWLEKNAGY… |
| A0A2I0HWT5 | 175-351 | None |
| A0A0A9DWU5 | 53-206 | None |
| A0A835Y5S6 | 609-736 | None |
| A0A199VUR7 | 52-214 | None |
| A0A1B8EES3 | 271-480 | None |
| A0A6A6N7Y1 | 165-365 | None |
| A0A383VKC6 | 178-298 | None |
| A0A151T945 | 448-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.