DPCstruct | MC1543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 65.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831Z4A9 | 1-59 | GLTDKPVIAVPTSVGYGSHFGGITALLAMLNSCANSITVVNIDNGFGAGYAAALILRQI |
| A0A3N0ATG8 | 156-207 | SAPVIAVPTSVGYGASFGGVTALLAMLNSCASGVSVVNIDNGFGAAFQASAI |
| A0A7V3Y3H7 | 1-58 | None |
| A0A239GXJ7 | 60-121 | None |
| K0SER5 | 340-391 | None |
| A0A7Y5VB81 | 420-473 | None |
| A0A7X4CBY2 | 17-74 | None |
| A0A7S0CZR9 | 52-120 | None |
| A0A2V7JDW0 | 159-208 | None |
| A0A2V8HYF6 | 170-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.